18+

Adults only

This season covers the business of the adult industry: companies, money, technology and regulation. There are no images and no adult content here, but the topic is 18+. Please confirm that you are 18 or older.

← Back to internet history
← all stories

Era 5 · Creator platforms and payment de-risking

2014–2026alive, private, Montreal; by a Semrush estimate, 32 million…

ManyVids

ManyVids is a Canadian platform from Montreal where independent creators sell clips, merchandise, subscriptions, and personal services, while the platform takes 20% to 40%. The stated launch was April 2014; the platform is visible in the archive from October 2013. In August 2021, while OnlyFans announced and then suspended a ban, citing the banks, ManyVids announced a promotion paying creators 85% and spoke of growth and of compliance with Visa and Mastercard rules. Alive and private, in 2025 it changed its tone and positioning.

Founders Bella French (co-founder and CEO)
Domains manyvids.com
creator-platformmarketplacepaymentscard-networkscompliance

In brief

ManyVids is a Canadian (Montreal) platform where independent creators sell video clips, merchandise, subscriptions, and personal services, while the platform takes a share: according to its FAQ as of January 2022, a creator receives 60% on clips and memberships and 80% on other services. The stated launch was April 2014; by 2018 it had about 16,000 creators and 1.7 million members, and by 2019, 2.4 million members and 120 employees (according to the company). Unlike OnlyFans, it is a storefront marketplace as well as a subscription: the paid unit is a clip or an item, and the subscription is only one of the layers. In August 2021, when OnlyFans announced a ban on explicit content, citing the banks, and suspended it six days later, ManyVids announced a promotion paying creators 85%, and in September its CEO spoke of growth in sign-ups and of compliance with the card networks' rules.

How it started (the founders)

The co-founder and CEO is Bella French, who came into the business from the creators' side; she describes the idea for the platform as a response to content theft on tube sites, a mix of Amazon, YouTube, and Twitter in which the rights stay with the creator.

The launch date is contested. The company and its profiles say it officially launched in April 2014; in an XBIZ item from January 22, 2018, a company representative says this is the first nomination since the company was founded in 2015; and the site archive shows a working page with the sections "Vids," "Girls," and "Be an MV Girl" and a shopping cart as early as October 23, 2013. Most likely this was a beta version before the official launch estimate. By February 2015, "Store Items," contests, and sales appear in the menu, meaning that from the very start the creator was a mini-store rather than just a supplier of clips. By 2014 the manyvids.com domain was already eight years old: in August 2006 it hosted a gateway page with ads for other people's paid sites and trial access for $1.85; a link between the owners of 2006 and of 2014 has not been established.

The principle the company emphasizes is that creators keep the rights to their content, they can post it on competing platforms, and there are no binding contracts.

Year-by-year timeline

Lesser-known but significant facts

  1. The platform is visible in the archive half a year before the "2014 launch." The October 23, 2013 snapshot already contains creators, a shopping cart, and documents, which means that the platform's founding date depends on whether the beta counts estimate.
  2. The creator's share is a ladder, not a single figure. In the 2022 FAQ: 80% on VIP FanClub subscriptions, custom videos, merchandise, and tips; 60% on clips and memberships. In 2019, webcam was 50%. There is no single platform commission; it depends on the type of product, and the 2024 payout table repeats the same 60% and 80%.
  3. The most expensive part for the creator is clips, not the subscription. The platform takes 40% of clip sales and 20% of FanClub subscriptions, so the creator gets more from the subscription than from the catalog.
  4. Payouts go through four channels instead of one. Direct deposit, Paxum, Cosmo Payment, Bitsafe; the 2024 help center also has a section on yoursafe, and from September 18, 2024 the payout schedule is weekly; the company has accepted crypto for at least five years, but says its share is minimal. Paxum is only for those outside the US or registered as corporations. This is insurance against any single partner dropping out estimate.
  5. Creator verification before the first sale. According to the FAQ, a creator must be approved so that the company can protect the creator's identity; according to a 2021 interview, this means an ID and a photo, plus documents for co-performers. This is exactly what AN 5196 has required since October 15, 2021 estimate.

Legend vs. the record

The first growth lever

What the documents show is not a single tactic but a set of conditions that made the platform attractive to creators. First, the creator keeps the rights and can post anywhere, without a contract. Second, the product for the creator is broader than a clip: a merchandise store, contests, and sales as early as 2015, and later custom videos and a FanClub with auto-renewal. Third, the platform's own traffic: MVTube paid creators 67 cents per 1,000 views. This resembles a free view → paid purchase funnel in which the platform shares with the creator even before the paid part estimate.

The growth figures are only the company's claims: about 16,000 creators and 1.7 million members in 2018, and 2.4 million members and 120 employees in 2019. The documents do not say which channel brought the main inflow estimate.

The paired story

Parallels today (projects from the catalog)

What a builder can take from this in 2026

  1. Mix monetization units. The ManyVids 2022 FAQ lists at least seven income types with an 80% share, plus clip sales and memberships with a 60% share, so the creator does not depend on a single mechanism. If you are building a platform for creators, plan for at least a subscription, a one-off purchase, and a service.
  2. The platform's price can depend on the product type. 20% on services and subscriptions and 40% on the catalog looks like a way to pay creators more where the platform invests less estimate; check where your distribution costs are.
  3. Creator verification before the first sale is part of the product, not a reaction to a ban. It is described in the FAQ and in a 2021 interview and matches the requirements of AN 5196. Build it into onboarding before a bank demands it.
  4. Do not rely on a single payout method. Four payout methods and crypto acceptance are insurance against a partner dropping out estimate.
  5. Back up growth with numbers. ManyVids claimed sign-up growth of almost 100%, but there are no independent figures: a private platform with no public reporting is left with the CEO's words against the data.
  6. Positioning is a risk too. The abrupt change of tone in 2025, according to press reports, alarmed creators estimate; explain your course with numbers and terms.

Discrepancies and what we could not verify

Sources (primary first)

Internet History Keeper

Every historical dossier here is free and open, and it will stay that way. If you want the series to keep going (new dossiers, checks against primary sources, the English edition), support it with a subscription for $9.90 a month. It is support, not access, and you can cancel at any time.

Become a keeper — $9.90 a month →

The same thing, about today

The same breakdowns, but of projects launching right now: what the product is, where the first users came from, how they charge. The card is free, the full dossier is $5 (the dossier itself is written in Russian).

Browse the dossier catalog →